Description

Buy VIP Peptide | Vasoactive Intestinal Peptide for Research | EU Research Peptides

Welcome to euresearchpeptides.com — your premier EU-based supplier of high purity research peptides, laboratory peptides, and research chemicals. If you are searching for buy VIP peptide Europe, Vasoactive Intestinal Peptide for sale, or a trusted peptide supplier Germany, you have found the authoritative source. buy vip peptide europe

VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide belonging to the glucagon-secretin superfamily. It functions as a potent vasodilator, immunomodulator, and neurotransmitter, making it invaluable for research in neurobiology, immunology, gastroenterology, and oncology. buy vip peptide europe

What Is VIP Peptide?

VIP is a synthetic, non-glycosylated polypeptide chain identical to the endogenous human sequence. This product is intended for laboratory research use only and is strictly not for human consumption or clinical application.

Our VIP peptide is ideal for:

• Neurobiology Research: Studies on synaptic plasticity, neuroprotection, and epilepsy .

• Immunology: Investigating inflammatory/autoimmune diseases, rheumatoid arthritis, and T-cell regulation .

• Gastroenterology: Research into smooth muscle relaxation and gastrointestinal motility.

• Oncology: Studies on VIP receptor antagonists and anti-leukemia activity .

How It Works: Mechanism of Action

VIP exerts its biological effects by binding with high affinity to G protein-coupled receptors (GPCRs), specifically VPAC1 and VPAC2 . This interaction activates the cyclic AMP (cAMP)-protein kinase A (PKA) signaling pathway, leading to:

• Vasodilation: Relaxation of vascular smooth muscle.

• Immunomodulation: Inhibition of pro-inflammatory cytokines and promotion of regulatory T-cell activity .

• Neuroprotection: Reduction of excitotoxicity and inflammation in models of epilepsy and neurodegenerative disorders .

Performance Benefits for Research

Solubility Profile & Reconstitution

VIP peptide is soluble in water at concentrations up to 1 mg/ml, yielding a colorless solution .

Recommended Reconstitution Protocol:

1. Centrifuge the vial briefly to collect lyophilized material at the bottom.

2. Reconstitute in sterile 18 MΩ-cm water to a concentration of at least 100 µg/ml .

3. Gently swirl — do not vortex.

4. For long-term storage, dilute further with sterile PBS containing 0.1% BSA or HSA as a carrier protein .

Stability & Storage Conditions

Known Research Applications & Citations

VIP has been extensively studied across multiple disease models:

• Rheumatoid Arthritis: Low serum VIP levels correlate with worse clinical disease course and higher treatment requirements. VIP exhibits protective effects in animal models of arthritis .

• Anti-Leukemia Activity: VIP receptor antagonists (e.g., ANT308) enhance T-cell activation and demonstrate potent anti-leukemia activity in murine models of acute myeloid leukemia .

• Epilepsy & Neuroprotection: VPAC1 receptor ligands are being investigated for their capacity to prevent epileptogenesis and provide neuroprotection in mesial-temporal lobe epilepsy (MTLE) models .

• Inflammatory Bowel Disease: VIP reverses endotoxic shock and shows protective effects in Crohn’s disease models .

• PEGylation Studies: Non-covalent PEGylation of VIP (using mPEG-cholane) dramatically increases peptide solubility and plasma stability, offering an alternative to covalent modification .

Safety Considerations & Handling

• For Laboratory Use Only: Not for human consumption, therapeutic use, or clinical diagnostics.

• Personal Protective Equipment (PPE): Always wear gloves, lab coat, and eye protection when handling.

• Disposal: Follow institutional guidelines for biohazardous waste disposal.

• Contraindications: Avoid contact with skin and mucous membranes.

Who Is This Best Suited For?

Why Customers Trust euresearchpeptides.com

We are a premium EU-based online retailer specializing in buy peptides EU, high purity peptides Germany, and peptides for research France. Our commitments:

• ISO 9001:2015 Certified manufacturing facilities.

• Third-party tested purity (>97% by HPLC) and mass verification by MS.

• Fast, discreet shipping across Europe, UK, and Canada.

• EU compliance with all research chemical regulations.

👉 Explore our complete catalog of research peptides at our official homepage.

Frequently Asked Questions (FAQ) – High Intent Commercial Keywords

1. Where can I buy VIP peptide in Europe for research purposes?
You can buy VIP peptide Europe directly from euresearchpeptides.com, a trusted peptide supplier Germany offering high purity peptides for research. We ship to Germany, France, Spain, Italy, Netherlands, UK, and Switzerland.

2. What is the purity of your Vasoactive Intestinal Peptide for sale?
Our Vasoactive Intestinal Peptide for sale is tested at >97% purity by RP-HPLC and verified by mass spectrometry. We provide a Certificate of Analysis (CoA) with every order.

3. What is the molecular weight and sequence of VIP peptide?
The VIP peptide molecular weight is 3325.8 Da. The VIP peptide sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28 amino acids) .

4. How do I reconstitute lyophilized VIP peptide?
Reconstitute lyophilized VIP peptide in sterile water to a concentration of at least 100 µg/ml. For long-term storage, dilute with PBS containing 0.1% BSA .

5. How should I store VIP peptide for maximum stability?
Store VIP peptide lyophilized at -20°C. After reconstitution, aliquot and store at -20°C for up to 3 months. Avoid repeated freeze-thaw cycles .

6. Is VIP peptide soluble in water or DMSO?
VIP peptide solubility: Soluble in water (1 mg/ml, colorless). Not typically dissolved in DMSO .

7. What are the research applications of Vasoactive Intestinal Peptide?
VIP peptide research applications include: neuroprotection, immunomodulation (rheumatoid arthritis, Crohn’s disease), anti-leukemia activity, and epilepsy studies .

8. Do you ship VIP peptide to the UK and Canada?
Yes, we ship research peptides UK and peptides for research Canada with discreet, fast shipping. All orders comply with local regulations for laboratory use only.

9. Can I buy VIP peptide in bulk for my laboratory?
Yes, we offer bulk VIP peptide and wholesale research peptides for universities, biotech companies, and CROs. Contact us for volume pricing.

10. Is VIP peptide the same as PACAP?
No. VIP and PACAP (Pituitary Adenylate Cyclase Activating Peptide) are distinct peptides but share receptor binding sites (VPAC1 and VPAC2). VIP is a 28-amino acid peptide; PACAP is 27 or 38 amino acids .

11. What is the difference between VPAC1 and VPAC2 receptors?
VPAC1 and VPAC2 are both G protein-coupled receptors for VIP. VPAC1 is widely expressed in immune cells and the CNS; VPAC2 is more restricted. VIP binds both with high affinity .

12. Do you offer overnight shipping for urgent research needs?
Yes, we offer express delivery for urgent research peptides EU orders. Select overnight shipping at checkout for next-day delivery within Germany and major EU cities.